PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1107441g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family TALE
Protein Properties Length: 535aa    MW: 59194.4 Da    PI: 7.5617
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1107441g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-094254621954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  PDK_30s1107441g002 425 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 462
                         664559******************************88 PP

2BELL126.59.8e-41286356272
                BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         r e+q+kkakL+s+l+eVd+rY++y++q+q+v++sF+ v+g g+a+pYt+lA+ka+SrhFrcLkdaiaeq+
  PDK_30s1107441g002 286 RFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNSFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAEQL 356
                         779******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-52252354IPR006563POX domain
PfamPF075263.9E-40279353IPR006563POX domain
PROSITE profilePS5007112.568403466IPR001356Homeobox domain
SMARTSM003891.2E-9406470IPR001356Homeobox domain
CDDcd000861.65E-13406467No hitNo description
SuperFamilySSF466898.13E-18407478IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28409471IPR009057Homeodomain-like
PfamPF059202.5E-18423462IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MGIATPPSQP ACPYLSPPKT VSRTPGRPNS PTSMSQGFHH GIFGFSDGFD RSTSQEQQQQ  60
QQHIAQQSRR DKLRVPGFEP GGHPLVPIEE QGEESSIYDS TAAAAGASNM LSEMFNFPTS  120
DLLAGQIYRQ TPRPGPMAGF SGDWYGANRQ GVVLGAPPPT LHHLHHHQQQ AFQSFSDASF  180
GGGVGESQGL SLSLSSSLQQ FEMPKAEELR VRDGVLYFNN QAQQQQQQQH LSSLHLQGHG  240
HGQAVHIECG PMGVVNVLRN AKYARAAQEL LEEFCSDLPP LSPADRFEHQ RKKAKLISML  300
DEVDRRYNHY CDQMQMVVNS FDSVMGFGAA TPYTALAQKA MSRHFRCLKD AIAEQLKQTC  360
ELLGEKEAGS SSGLTKGETP RLRLIDQSLR QQRAFHQMGM MEQEAWRPQR GLPERSVNIL  420
RAWLFEHFLH PYPSDADKHL LARQTGLSRN QVSNWFINAR VRLWKPMVEE MSDVHMGPTD  480
DTYRYGATSA ATLGPAAQMR FGTAGDVSLT LGLRHAGGNA AEKGARFSVR DFSGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16412470563Homeobox protein Meis2
3k2a_B1e-16412470563Homeobox protein Meis2
4xrm_A1e-16412470563Homeobox protein Meis2
4xrm_B1e-16412470563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2759960.0JX275996.1 Cocos nucifera microsatellite WCYZ8483 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008813264.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLM0TL800.0M0TL80_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27440_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-131BEL1-like homeodomain 4